Structure of PDB 8dtn Chain C Binding Site BS01

Receptor Information
>8dtn Chain C (length=117) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVQLVESGGGLVQAGGSLRLSCAASGFIFDSYAMGWYRQAPGKEMELVAA
ITSSGSSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAALD
YVIDGYWGQGTQVTVSS
Ligand information
>8dtn Chain D (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVYKCEICKMPFSVYSTLEKHMKKWHSD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtn Evolution of nanobodies specific for BCL11A.
Resolution2.199 Å
Binding residue
(original residue number in PDB)		S31 A33 Y37 L47 I51 T52 Y59 L99 D100 V102
Binding residue
(residue number reindexed from 1)		S31 A33 Y37 L47 I51 T52 Y59 L99 D100 V102
External links