Structure of PDB 8do8 Chain C Binding Site BS01

Receptor Information
>8do8 Chain C (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGT
QDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEF
YQKKKSRWPFSDECIPWEVWTVKVHVVERQICREKVGEKLCEKIINIVEV
MNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8do8 Structural basis for ATG9A recruitment to the ULK1 complex in mitophagy initiation.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		G43 T44 Y45 I47
Binding residue
(residue number reindexed from 1)		G41 T42 Y43 I45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0000045 autophagosome assembly
GO:0006914 autophagy
GO:0008285 negative regulation of cell population proliferation
GO:0010508 positive regulation of autophagy
GO:1903059 regulation of protein lipidation
Cellular Component
GO:0000407 phagophore assembly site
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:1990316 Atg1/ULK1 kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8do8, PDBe:8do8, PDBj:8do8
PDBsum8do8
PubMed36791199
UniProtQ9BSB4|ATGA1_HUMAN Autophagy-related protein 101 (Gene Name=ATG101)

[Back to BioLiP]