Structure of PDB 8d94 Chain C Binding Site BS01

Receptor Information
>8d94 Chain C (length=455) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHN
RFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPF
SHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEE
DICFIKEQIVGPLELWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARD
CHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSL
HRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAY
TKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIK
REDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVS
FYCKTAPNRAIRIPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNF
TKPQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d94 SAMHD1-DNA complex
Resolution2.44 Å
Binding residue
(original residue number in PDB)		K116 V117 I118 N119 D137
Binding residue
(residue number reindexed from 1)		K3 V4 I5 N6 D24
Enzymatic activity
Enzyme Commision number 3.1.5.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003697 single-stranded DNA binding
GO:0003723 RNA binding
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0008832 dGTPase activity
GO:0016787 hydrolase activity
GO:0016793 triphosphoric monoester hydrolase activity
GO:0032567 dGTP binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0106375 deoxynucleoside triphosphate hydrolase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006203 dGTP catabolic process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006955 immune response
GO:0006974 DNA damage response
GO:0009264 deoxyribonucleotide catabolic process
GO:0016446 somatic hypermutation of immunoglobulin genes
GO:0045087 innate immune response
GO:0045088 regulation of innate immune response
GO:0046061 dATP catabolic process
GO:0051289 protein homotetramerization
GO:0051607 defense response to virus
GO:0060339 negative regulation of type I interferon-mediated signaling pathway
GO:0110025 DNA strand resection involved in replication fork processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005886 plasma membrane
GO:0035861 site of double-strand break
GO:0097197 tetraspanin-enriched microdomain

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d94, PDBe:8d94, PDBj:8d94
PDBsum8d94
PubMed
UniProtQ9Y3Z3|SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (Gene Name=SAMHD1)

[Back to BioLiP]