Structure of PDB 8d5q Chain C Binding Site BS01

Receptor Information
>8d5q Chain C (length=176) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVP
WMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYG
CDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQA
GAAEYYRAYLEGECVEWLHRYLKNGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d5q Peptide Centric V beta Specific Germline Contacts Shape a Specialist T Cell Response.
Resolution2.501 Å
Binding residue
(original residue number in PDB)
Y7 Y59 I63 Q70 W73 N77 L81 Y84 W97 Y99 F116 T143 K146 W147 A150 Y155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y59 I63 Q70 W73 N77 L81 Y84 W97 Y99 F116 T143 K146 W147 A150 Y155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8d5q, PDBe:8d5q, PDBj:8d5q
PDBsum8d5q
PubMed35967379
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]