Structure of PDB 8ctc Chain C Binding Site BS01

Receptor Information
>8ctc Chain C (length=406) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILMRMLKLI
ILPLIISSMITGVAALDSNVSGKIGLRAVVYYFATTLIAVILGIVLVVSI
KPGSTVDAMLDLIRNMFPENLVQAAFQQYKTKREEYKIVGMYSDGINVLG
LIVFALVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMWYMPLGILF
LIAGCIIEVEDWEIFRKLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPF
RFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLPVGAT
INMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQA
GLVTMVIVLSAVGLPAEDVTLIIAVDCLLDRFRTMVNVLGDAFGTGIVEK
LSKKEL
Ligand information
Ligand IDGLU
InChIInChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/t3-/m0/s1
InChIKeyWHUUTDBJXJRKMK-VKHMYHEASA-N
SMILES
SoftwareSMILES
ACDLabs 12.01O=C(O)C(N)CCC(=O)O
OpenEye OEToolkits 1.7.0C(CC(=O)O)C(C(=O)O)N
OpenEye OEToolkits 1.7.0C(CC(=O)O)[C@@H](C(=O)O)N
CACTVS 3.370N[C@@H](CCC(O)=O)C(O)=O
CACTVS 3.370N[CH](CCC(O)=O)C(O)=O
FormulaC5 H9 N O4
NameGLUTAMIC ACID
ChEMBLCHEMBL575060
DrugBankDB00142
ZINCZINC000001482113
PDB chain8ctc Chain C Residue 600 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ctc Symport and antiport mechanisms of human glutamate transporters.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S332 S333 M367 T370 G410 A414 D444 R447
Binding residue
(residue number reindexed from 1)		S268 S269 M303 T306 G346 A350 D380 R383
Annotation score5
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005253 monoatomic anion channel activity
GO:0005313 L-glutamate transmembrane transporter activity
GO:0005314 high-affinity L-glutamate transmembrane transporter activity
GO:0005515 protein binding
GO:0015108 chloride transmembrane transporter activity
GO:0015179 L-amino acid transmembrane transporter activity
GO:0015183 L-aspartate transmembrane transporter activity
GO:0015293 symporter activity
GO:0015501 glutamate:sodium symporter activity
GO:0016595 glutamate binding
GO:0033229 cysteine transmembrane transporter activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140010 D-aspartate transmembrane transporter activity
Biological Process
GO:0001662 behavioral fear response
GO:0001975 response to amphetamine
GO:0002027 regulation of heart rate
GO:0006749 glutathione metabolic process
GO:0006750 glutathione biosynthetic process
GO:0006801 superoxide metabolic process
GO:0006811 monoatomic ion transport
GO:0006836 neurotransmitter transport
GO:0006865 amino acid transport
GO:0006882 intracellular zinc ion homeostasis
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007268 chemical synaptic transmission
GO:0007420 brain development
GO:0007611 learning or memory
GO:0007613 memory
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0009410 response to xenobiotic stimulus
GO:0010460 positive regulation of heart rate
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0015813 L-glutamate transmembrane transport
GO:0019221 cytokine-mediated signaling pathway
GO:0022008 neurogenesis
GO:0030534 adult behavior
GO:0034599 cellular response to oxidative stress
GO:0035633 maintenance of blood-brain barrier
GO:0036293 response to decreased oxygen levels
GO:0042417 dopamine metabolic process
GO:0042883 cysteine transport
GO:0043278 response to morphine
GO:0043524 negative regulation of neuron apoptotic process
GO:0045184 establishment of protein localization
GO:0048514 blood vessel morphogenesis
GO:0048678 response to axon injury
GO:0050808 synapse organization
GO:0051402 neuron apoptotic process
GO:0051938 L-glutamate import
GO:0060013 righting reflex
GO:0060041 retina development in camera-type eye
GO:0060047 heart contraction
GO:0060291 long-term synaptic potentiation
GO:0061744 motor behavior
GO:0070633 transepithelial transport
GO:0070777 D-aspartate transmembrane transport
GO:0070778 L-aspartate transmembrane transport
GO:0070779 D-aspartate import across plasma membrane
GO:0071242 cellular response to ammonium ion
GO:0071288 cellular response to mercury ion
GO:0071314 cellular response to cocaine
GO:0071407 cellular response to organic cyclic compound
GO:0071577 zinc ion transmembrane transport
GO:0072347 response to anesthetic
GO:0090313 regulation of protein targeting to membrane
GO:0090461 intracellular glutamate homeostasis
GO:0097049 motor neuron apoptotic process
GO:0098712 L-glutamate import across plasma membrane
GO:0098877 neurotransmitter receptor transport to plasma membrane
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:0140009 L-aspartate import across plasma membrane
GO:0150104 transport across blood-brain barrier
GO:1902476 chloride transmembrane transport
GO:1903712 cysteine transmembrane transport
GO:1903926 cellular response to bisphenol A
GO:1990708 conditioned place preference
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0031901 early endosome membrane
GO:0031902 late endosome membrane
GO:0031982 vesicle
GO:0032279 asymmetric synapse
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043083 synaptic cleft
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0045121 membrane raft
GO:0045202 synapse
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:0097386 glial cell projection
GO:0097440 apical dendrite
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0099544 perisynaptic space
GO:0150002 distal dendrite
GO:1990635 proximal dendrite

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ctc, PDBe:8ctc, PDBj:8ctc
PDBsum8ctc
PubMed37142617
UniProtP43005|EAA3_HUMAN Excitatory amino acid transporter 3 (Gene Name=SLC1A1)

[Back to BioLiP]