Structure of PDB 8cmo Chain C Binding Site BS01

Receptor Information

>8cmo Chain C (length=80) Species: 75800 (Coelastrella)

SHIVKIYDTCIGCTQCVRACPLDVLEMVPWNGCKANQMASAPRTEDCVGC
KRCETACPTDFLSVRVYLGSESTRSMGLSY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 8cmo Chain C Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8cmo Cryo-EM structure of the Photosystem I - LHCI supercomplex from Coelastrella sp.
• Resolution: 2.81 Å
• Binding residue (original residue number in PDB): C21 P22 V25 L26 C48 V49 G50 C51 K52 C54 V67
• Binding residue (residue number reindexed from 1): C20 P21 V24 L25 C47 V48 G49 C50 K51 C53 V66
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 04:52:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8cmo', asym_id = 'C', bs = 'BS01', title = 'Cryo-EM structure of the Photosystem I - LHCI supercomplex from Coelastrella sp.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8cmo', asym_id='C', bs='BS01', title='Cryo-EM structure of the Photosystem I - LHCI supercomplex from Coelastrella sp.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0009055,0009522,0009773,0015979,0042651,0051539', uniprot = '', pdbid = '8cmo', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0009522,0009773,0015979,0042651,0051539', uniprot='', pdbid='8cmo', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>