Structure of PDB 8cj1 Chain C Binding Site BS01

Receptor Information
>8cj1 Chain C (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cj1 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution2.564 Å
Binding residue
(original residue number in PDB)		D37 D58 S59 V60 L61 G63 Q75
Binding residue
(residue number reindexed from 1)		D37 D58 S59 V60 L61 G63 Q75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cj1, PDBe:8cj1, PDBj:8cj1
PDBsum8cj1
PubMed37347155
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]