Structure of PDB 8cef Chain C Binding Site BS01

Receptor Information
>8cef Chain C (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEI
TKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cef Asymmetric dimerization in a transcription factor superfamily is promoted by allosteric interactions with DNA.
Resolution2.486 Å
Binding residue
(original residue number in PDB)		Y89 H90 Y91 K100 K104 V149 R150 R153 R155
Binding residue
(residue number reindexed from 1)		Y16 H17 Y18 K27 K31 V76 R77 R80 R82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cef, PDBe:8cef, PDBj:8cef
PDBsum8cef
PubMed37503845
UniProtO08580|ERR1_MOUSE Steroid hormone receptor ERR1 (Gene Name=Esrra)

[Back to BioLiP]