Structure of PDB 8c1t Chain C Binding Site BS01

Receptor Information
>8c1t Chain C (length=89) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYLDIVLLRGSSGLGFSIAGGTDNPHFDNDTSIYITKVIPGGAAEADGRL
KVYDTIVAVDDQLMEDVAHQVCVDALKSAGSEVKLRVKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c1t Crystal structure of Trichoplax Dlg PDZ1 domain in complex with Trichoplax Vangl peptide
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G13 L14 F16 S17 I18 N24 T36 H69
Binding residue
(residue number reindexed from 1)		G13 L14 F16 S17 I18 N24 T36 H69
Enzymatic activity
Enzyme Commision number ?
External links