Structure of PDB 8bzl Chain C Binding Site BS01

Receptor Information
>8bzl Chain C (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKAKL
QDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVT
VEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTY
HAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQGGK
NIELAVMRRDQSLKILNPEEIEKYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bzl Peptidic, Blm10-based activators of human 20S proteasome in vitro and in cellulo enhance degradation of proteins connected with neurodegeneration.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		A25 K28 S30 K61 A74 G75 L76 T77
Binding residue
(residue number reindexed from 1)		A24 K27 S29 K58 A71 G72 L73 T74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bzl, PDBe:8bzl, PDBj:8bzl
PDBsum8bzl
PubMed
UniProtO14818|PSA7_HUMAN Proteasome subunit alpha type-7 (Gene Name=PSMA7)

[Back to BioLiP]