Structure of PDB 8byl Chain C Binding Site BS01

Receptor Information
>8byl Chain C (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGW
VHYMIHEPEPHILLFRRPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8byl Cryo-EM structure of SKP1-SKP2-CKS1 in complex with CDK2-cyclin A-p27KIP1.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y3008 R3020 R3044 Q3049 Q3050 S3051 Q3052
Binding residue
(residue number reindexed from 1)		Y4 R16 R40 Q45 Q46 S47 Q48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019901 protein kinase binding
GO:0042393 histone binding
GO:0043130 ubiquitin binding
GO:0061575 cyclin-dependent protein serine/threonine kinase activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007346 regulation of mitotic cell cycle
GO:0044772 mitotic cell cycle phase transition
GO:0048144 fibroblast proliferation
GO:0051301 cell division
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0005654 nucleoplasm
GO:0019005 SCF ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8byl, PDBe:8byl, PDBj:8byl
PDBsum8byl
PubMed37400515
UniProtP61024|CKS1_HUMAN Cyclin-dependent kinases regulatory subunit 1 (Gene Name=CKS1B)

[Back to BioLiP]