Structure of PDB 8bv1 Chain C Binding Site BS01

Receptor Information
>8bv1 Chain C (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE
EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTY
RGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHI
NW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bv1 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution2.834 Å
Binding residue
(original residue number in PDB)		A48 E51 D54 D88 V92 V94 R108 Y112 R145
Binding residue
(residue number reindexed from 1)		A47 E50 D53 D87 V91 V93 R107 Y111 R144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bv1, PDBe:8bv1, PDBj:8bv1
PDBsum8bv1
PubMed37347155
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]