Structure of PDB 8bq8 Chain C Binding Site BS01

Receptor Information
>8bq8 Chain C (length=93) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSLMNIVLHKEDKGLGFSIAGGVGNQHIINDNGIFVTKIIEGGAAFQD
GRLEVGDRITKVNTLSLENVTHEEAVAILKETADVVSLVVVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bq8 Crystal structure of Trichoplax Dlg PDZ2 domain in complex with Trichoplax Vangl peptide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		L329 F331 S332 I333 A334 T351 H384 V388 L391 K392
Binding residue
(residue number reindexed from 1)		L17 F19 S20 I21 A22 T39 H72 V76 L79 K80
Enzymatic activity
Enzyme Commision number ?
External links