Structure of PDB 8b5x Chain C Binding Site BS01

Receptor Information
>8b5x Chain C (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTAL
MSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAA
FTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGES
LQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPV
Ligand information
>8b5x Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEDSWTSLEHILWPFTRLRHNGPPPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b5x Crystal structure of SUN1-KASH6 reveals an asymmetric higher order LINC architecture compatible with nuclear membrane insertion
Resolution1.98 Å
Binding residue
(original residue number in PDB)		E646 G648 G649 G650 S651 S654 M668 W676 F678 S681 R683 E748
Binding residue
(residue number reindexed from 1)		E29 G31 G32 G33 S34 S37 M51 W59 F61 S64 R66 E131
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b5x, PDBe:8b5x, PDBj:8b5x
PDBsum8b5x
PubMed38291267
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]