Structure of PDB 8b5b Chain C Binding Site BS01

Receptor Information
>8b5b Chain C (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDA
VKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIY
NKPGDDIVLMAEALEKLFLQKINELPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b5b Synthesis, Biochemical Characterization, and Genetic Encoding of a 1,2,4-Triazole Amino Acid as an Acetyllysine Mimic for Bromodomains of the BET Family.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		W81 V87 L92 N93 D96 I138 Y139 N140 D145 I146 M149
Binding residue
(residue number reindexed from 1)		W42 V48 L53 N54 D57 I99 Y100 N101 D106 I107 M110
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b5b, PDBe:8b5b, PDBj:8b5b
PDBsum8b5b
PubMed36585954
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]