Structure of PDB 8a5b Chain C Binding Site BS01

Receptor Information

>8a5b Chain C (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSE
QNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKY
NPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGI
YFEPDCSSEDMDHGVLVVGYGFESNNKYWLVKNSWGEEWGMGGYVKMAKD
RRNHCGIASAASYPTV

Ligand information

>8a5b Chain G (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8a5b Structural elucidation of antiviral cathepsin L inhibitors
Resolution	1.8 Å
Binding residue (original residue number in PDB)	G23 C25 E63 G67 G68 L69 M70 D162 H163
Binding residue (residue number reindexed from 1)	G23 C25 E63 G67 G68 L69 M70 D162 H163

Enzymatic activity

Enzyme Commision number

3.4.22.15: cathepsin L.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8a5b, PDBe:8a5b, PDBj:8a5b
PDBsum	8a5b
PubMed	38630165
UniProt	P07711\|CATL1_HUMAN Procathepsin L (Gene Name=CTSL)

[Back to BioLiP]