Structure of PDB 7zxy Chain C Binding Site BS01

Receptor Information
>7zxy Chain C (length=279) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPFWAQETAPLTPREATGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVV
KIPYDLDSQQVLGDGSKGGLNVGAVLMLPEGFKIAPPDRLSEGLKEKVGG
TYFQPYREDMENVVIVGPLPGEQYQEIVFPVLSPDPAKDKSINYGKFAVH
LGANRGRGQIYPTGLLSNNNAFKAPNAGTISEVNALEAGGYQLIGTETVD
IPAGPELIVSAGQTVEAGEFLTNNPNVGGFGQKDTEVVLQNPTRIKFLVL
FLAGIMLSQILLVLKKKQIEKVQAAELNF
Ligand information
>7zxy Chain H (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDILTLGWVSVLVLFTWSISMVVWGRNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Q38 A39 L41 P248 I251 K252 V255 L258 M262 Q265 I266 V269 K272 K273
Binding residue
(residue number reindexed from 1)		Q38 A39 L41 P242 I245 K246 V249 L252 M256 Q259 I260 V263 K266 K267
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum7zxy
PubMed35726684
UniProtP26287|CYF_SYNY3 Cytochrome f (Gene Name=petA)

[Back to BioLiP]