Structure of PDB 7zpk Chain C Binding Site BS01

Receptor Information
>7zpk Chain C (length=233) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFR
VTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSSECNPVGALQELVVQK
GWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKM
LLRVHTVPSACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQP
ATVCYGSATTREAARGDAAHRALQYLRIMAGSK
Ligand information
>7zpk Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagcagcacauaaugguuuguggauguugggugcaggccauacugugcug
ccuca
..<<<<<<<<..<<<<<<<<<<.........>>>>>>>>>>..>>>>>>>
>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zpk Structural and functional basis of mammalian microRNA biogenesis by Dicer.
Resolution3.81 Å
Binding residue
(original residue number in PDB)		K29 I32 S33 Q36 A57 P60 K80 K81 K209
Binding residue
(residue number reindexed from 1)		K14 I17 S18 Q21 A42 P45 K65 K66 K139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005515 protein binding
GO:0035197 siRNA binding
GO:0035198 miRNA binding
GO:0042803 protein homodimerization activity
GO:0070883 pre-miRNA binding
Biological Process
GO:0006417 regulation of translation
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0030422 siRNA processing
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0035196 miRNA processing
GO:0035264 multicellular organism growth
GO:0043403 skeletal muscle tissue regeneration
GO:0045070 positive regulation of viral genome replication
GO:0045727 positive regulation of translation
GO:0046782 regulation of viral transcription
GO:0050689 negative regulation of defense response to virus by host
GO:0051149 positive regulation of muscle cell differentiation
GO:0061351 neural precursor cell proliferation
GO:0070921 regulation of siRNA processing
GO:0070922 RISC complex assembly
GO:0098795 global gene silencing by mRNA cleavage
GO:1903798 regulation of miRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016442 RISC complex
GO:0048471 perinuclear region of cytoplasm
GO:0070578 RISC-loading complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zpk, PDBe:7zpk, PDBj:7zpk
PDBsum7zpk
PubMed36332606
UniProtP97473|TRBP2_MOUSE RISC-loading complex subunit TARBP2 (Gene Name=Tarbp2)

[Back to BioLiP]