Structure of PDB 7zl4 Chain C Binding Site BS01

Receptor Information
>7zl4 Chain C (length=155) Species: 470 (Acinetobacter baumannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVTGQVDVKLNISTGCTVGGSQTEGNMNKFGTLNFGKTSGTWNNVLTAEV
ASAATGGNISVTCDGTDPVDFTVAIDGGERTDRTLKNTASADVVAYNVYR
DAARTNLYVVNQPQQFTTVSGQATAVPIFGAIAPNTGTPKAQGDYKDTLL
VTVNF
Ligand information
>7zl4 Chain D (length=14) Species: 470 (Acinetobacter baumannii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVTGQVDVKLNIST
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zl4 Archaic chaperone-usher pili self-secrete into superelastic zigzag springs.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		M27 N28 K29 F30 G31 T32 L33 F35 K37 T38 L85 Y96 K140 Q142 G143 D144 Y145 K146 D147 T148 L149 L150 V151 T152 V153 F155
Binding residue
(residue number reindexed from 1)		M27 N28 K29 F30 G31 T32 L33 F35 K37 T38 L85 Y96 K140 Q142 G143 D144 Y145 K146 D147 T148 L149 L150 V151 T152 V153 F155
Enzymatic activity
Enzyme Commision number ?
External links