Structure of PDB 7zg3 Chain C Binding Site BS01

Receptor Information
>7zg3 Chain C (length=310) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRHRTLSSSPALWASIPCPRSELRLDLVLASGQSFRWKEQSPAHWSGVL
ADQVWTLTQTEDQLYCTVYRGDDSQVSRPTLEELETLHKYFQLDVSLAQL
YSHWASVDSHFQRVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITGMV
ERLCQAFGPRLIQLDDVTYHGFPNLHALAGPEAETHLRKLGLGYRARYVR
ASAKAILEEQGGPAWLQQLRVAPYEEAHKALCTLPGVGAKVADCICLMAL
DKPQAVPVDVHVWQIAHRDYGWHPKGPSPLANKELGNFFRNLWGPYAGWA
QAVLFSADLR
Ligand information
Ligand IDIUX
InChIInChI=1S/C14H17N3O/c1-13(2)8-14(13,3)16-12(18)11-7-10-5-4-6-17(10)9-15-11/h4-7,9H,8H2,1-3H3,(H,16,18)/t14-/m0/s1
InChIKeyAMNHFJHFCQKFMV-AWEZNQCLSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7CC1(CC1(C)NC(=O)c2cc3cccn3cn2)C
OpenEye OEToolkits 2.0.7C[C@@]1(CC1(C)C)NC(=O)c2cc3cccn3cn2
CACTVS 3.385CC1(C)C[C@]1(C)NC(=O)c2cc3cccn3cn2
CACTVS 3.385CC1(C)C[C]1(C)NC(=O)c2cc3cccn3cn2
FormulaC14 H17 N3 O
Name~{N}-[(1~{S})-1,2,2-trimethylcyclopropyl]pyrrolo[1,2-c]pyrimidine-3-carboxamide
ChEMBL
DrugBank
ZINC
PDB chain7zg3 Chain C Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zg3 Structure of the mouse 8-oxoguanine DNA Glycosylase mOGG1 in complex with ligand TH011228
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G42 F45 I155 K249 L256 M257 A316 F319
Binding residue
(residue number reindexed from 1)		G33 F36 I146 K240 L247 M248 A302 F305
Annotation score1
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0000702 oxidized base lesion DNA N-glycosylase activity
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0008017 microtubule binding
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0019899 enzyme binding
GO:0032357 oxidized purine DNA binding
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0140097 catalytic activity, acting on DNA
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0009314 response to radiation
GO:0009410 response to xenobiotic stimulus
GO:0009416 response to light stimulus
GO:0032355 response to estradiol
GO:0034614 cellular response to reactive oxygen species
GO:0043066 negative regulation of apoptotic process
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0045471 response to ethanol
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051593 response to folic acid
GO:0071276 cellular response to cadmium ion
GO:1901291 negative regulation of double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0016363 nuclear matrix
GO:0016607 nuclear speck
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zg3, PDBe:7zg3, PDBj:7zg3
PDBsum7zg3
PubMed
UniProtO08760|OGG1_MOUSE N-glycosylase/DNA lyase (Gene Name=Ogg1)

[Back to BioLiP]