Structure of PDB 7z8y Chain C Binding Site BS01

Receptor Information
>7z8y Chain C (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTAL
MSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAA
FTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGES
LQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z8y Crystal structure of SUN1-KASH6 reveals a novel LINC complex conformation in which KASH molecules are oriented for nuclear membrane insertion.
Resolution2.29 Å
Binding residue
(original residue number in PDB)
A666 L667 M668 S669 L670 F671 A697 S735 Y798 Y802
Binding residue
(residue number reindexed from 1)
A49 L50 M51 S52 L53 F54 A80 S118 Y181 Y185
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7z8y, PDBe:7z8y, PDBj:7z8y
PDBsum7z8y
PubMed38291267
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]