Structure of PDB 7z50 Chain C Binding Site BS01

Receptor Information
>7z50 Chain C (length=181) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFG
QLILFEPQGGLQNIAAEKHNLGCLTKRSNFTPATNEAPQATVFPKSPVLL
GQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLS
YLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z50 Structural plasticity in I-A g7 links autoreactivity to hybrid insulin peptides in type I diabetes.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		Y10 I54 L55 F56 Q63 N64 A67 H70 N71 C74 R78
Binding residue
(residue number reindexed from 1)		Y9 I53 L54 F55 Q62 N63 A66 H69 N70 C73 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z50, PDBe:7z50, PDBj:7z50
PDBsum7z50
PubMed35967292
UniProtP04228|HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]