Structure of PDB 7z0o Chain C Binding Site BS01

Receptor Information

KPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE

Ligand information

cccctcccattacaaactaaaatcttacttttattttct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	7z0o Mechanism of RNA polymerase I selection by transcription factor UAF.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	P39 H40 Y42 K43 R50 R53 R54
Binding residue (residue number reindexed from 1)	P2 H3 Y5 K6 R13 R16 R17

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:7z0o, PDBe:7z0o, PDBj:7z0o
PDBsum	7z0o
PubMed	35442737
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)