Structure of PDB 7yxo Chain C Binding Site BS01

Receptor Information

>7yxo Chain C (length=237) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PTLISLLEVIEPEVLYSGYDSTSTRLMSTLNRLGGRQVVSAVKWAKALPG
FRNLHLDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVINEER
MQLPYMYDQCQQMLKISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQ
AVFDEIRMTYIKELGKAIVKRQNWQRFYQLTKLLDSMHEMVGGLLQFCFY
TFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFH

Ligand information

>7yxo Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PAILYALLS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7yxo The multivalency of the glucocorticoid receptor ligand-binding domain explains its manifold physiological activities.
Resolution	2.99 Å
Binding residue (original residue number in PDB)	V575 L589 M593 E751 M752 E755 N759
Binding residue (residue number reindexed from 1)	V42 L56 M60 E213 M214 E217 N221

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0034056	estrogen response element binding

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II
GO:0030518	nuclear receptor-mediated steroid hormone signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7yxo, PDBe:7yxo, PDBj:7yxo
PDBsum	7yxo
PubMed	36464162
UniProt	A0A1X8XLE9

[Back to BioLiP]