Structure of PDB 7ykh Chain C Binding Site BS01

Receptor Information
>7ykh Chain C (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSK
LVSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLR
HYLNLRFQKGSVDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFIT
VEEFMELEKSGALLESGTYEDNYYGTPKPPAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ykh The cryptic GK domain of MAGI binds to a diverse set of targets in a phosphorylation-dependent manner
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R130 Y134 T137 P139 R143 Y155 E174 G176 T177 Y178 Y183 G184 T185
Binding residue
(residue number reindexed from 1)
R121 Y125 T128 P130 R134 Y146 E165 G167 T168 Y169 Y174 G175 T176
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ykh, PDBe:7ykh, PDBj:7ykh
PDBsum7ykh
PubMed37163606
UniProtQ9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)

[Back to BioLiP]