Structure of PDB 7ykf Chain C Binding Site BS01

Receptor Information
>7ykf Chain C (length=183) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGS
KLVSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDL
RHYLNLRFQKGSVDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFI
TVEEFMELEKSGALLESGTYEDNYYGTPKPPAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ykf The cryptic GK domain of MAGI binds to a diverse set of targets in a phosphorylation-dependent manner
Resolution2.28 Å
Binding residue
(original residue number in PDB)
Y125 L126 T128 P130 R134 Y146 E165 G167 T168 Y169 Y174 G175 T176
Binding residue
(residue number reindexed from 1)
Y126 L127 T129 P131 R135 Y147 E166 G168 T169 Y170 Y175 G176 T177
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ykf, PDBe:7ykf, PDBj:7ykf
PDBsum7ykf
PubMed37163606
UniProtQ9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)

[Back to BioLiP]