Structure of PDB 7yew Chain C Binding Site BS01

Receptor Information
>7yew Chain C (length=160) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCPDEGW
ALKAIEALSGKMELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDS
LLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTL
KVAYIPDETA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yew Structure of MmIGF2BP3 in complex with 7-mer RNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)
Y5 L34 K36 Y39 F41 S73 V74 K76 R79
Binding residue
(residue number reindexed from 1)
Y6 L35 K37 Y40 F42 S74 V75 K77 R80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7yew, PDBe:7yew, PDBj:7yew
PDBsum7yew
PubMed
UniProtQ9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 (Gene Name=Igf2bp3)

[Back to BioLiP]