Structure of PDB 7ydw Chain C Binding Site BS01

Receptor Information

>7ydw Chain C (length=92) Species: 10090 (Mus musculus)

RAVTLRVLLKDELLEPGEGVLSIYYLGRKFTGDLQLDGRIVWQETGQVFN
SPSAWATHCKKLVNPAKKSGWASVKYKGQKLDKYKAAWLRRH

Ligand information

>7ydw Chain F (length=10)

tttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ydw Structures of MPND Reveal the Molecular Recognition of Nucleosomes.
• Resolution: 2.47 Å
• Binding residue (original residue number in PDB): S113 S115 W135
• Binding residue (residue number reindexed from 1): S51 S53 W71

Enzymatic activity

• Enzyme Commision number: 3.4.-.-

External links

• PDB: RCSB:7ydw, PDBe:7ydw, PDBj:7ydw
• PDBsum: 7ydw
• PubMed: 36834777
• UniProt: Q3TV65|MPND_MOUSE MPN domain-containing protein (Gene Name=Mpnd)