Structure of PDB 7xzy Chain C Binding Site BS01

Receptor Information

>7xzy Chain C (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN
IQAVLLPKK

Ligand information

>7xzy Chain I (length=165) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgagccaggcctgagaatccggtgccgaggccgctcaattggtcgtagac
agctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaac
cgccaaggggattactccctagtctccaggcacgtgtcagatatagggca
tgtccgggcatgtcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7xzy Structural basis for p53 binding to its nucleosomal target DNA sequence.
Resolution	3.97 Å
Binding residue (original residue number in PDB)	R11 R17 R32 R35
Binding residue (residue number reindexed from 1)	R1 R7 R22 R25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0008285	negative regulation of cell population proliferation
GO:0031507	heterochromatin formation
GO:0061644	protein localization to CENP-A containing chromatin

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0043505	CENP-A containing nucleosome
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xzy, PDBe:7xzy, PDBj:7xzy
PDBsum	7xzy
PubMed	36714865
UniProt	P04908\|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]