Structure of PDB 7xrc Chain C Binding Site BS01

Receptor Information
>7xrc Chain C (length=134) Species: 10088 (Mus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFE
ALQLSFKNMCKLKPLLNKWLEEADSSTSIEVSVKGALESHFLKCPKPSAQ
EITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xrc The homeodomain of Oct4 is a dimeric binder of methylated CpG elements.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		Q288 T289 C292 T506 S507 I508 K513 N551
Binding residue
(residue number reindexed from 1)		Q43 T44 C47 T77 S78 I79 K84 N122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xrc, PDBe:7xrc, PDBj:7xrc
PDBsum7xrc
PubMed36631980
UniProtP20265|PO3F2_HUMAN POU domain, class 3, transcription factor 2 (Gene Name=POU3F2)

[Back to BioLiP]