Structure of PDB 7xjg Chain C Binding Site BS01

Receptor Information
>7xjg Chain C (length=132) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKKFTDEQQQQLIGHLTKKGFYRGAILYAERFLLPCIYLLDSVNYRTLC
ELAFKAIKDVLSKIIVRSVVSRLINERKILQMTDGYQVTALGASYVRSVF
DRKTLDRLRLEIMNFENRRKSTFNYDKIPYAH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xjg Cryo-EM structures of Escherichia coli Ec86 retron complexes reveal architecture and defence mechanism.
Resolution2.51 Å
Binding residue
(original residue number in PDB)		R276 K277 T296 Y304
Binding residue
(residue number reindexed from 1)		R102 K103 T122 Y130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:7xjg, PDBe:7xjg, PDBj:7xjg
PDBsum7xjg
PubMed35982312
UniProtP0DV88|RIB86_ECOLX Retron Ec86 putative ribosyltransferase/DNA-binding protein (Gene Name=LM2_00875)

[Back to BioLiP]