Structure of PDB 7xfj Chain C Binding Site BS01

Receptor Information
>7xfj Chain C (length=101) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPN
I
Ligand information
>7xfj Chain I (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgacacgcgcctggagactagggagtaatccccttggcggttaaaacgc
gggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgacc
aattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfj Structural and mechanistic insights into the DNA glycosylase AAG-mediated base excision in nucleosome.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R11 R17 R20 R32 R77
Binding residue
(residue number reindexed from 1)		R1 R7 R10 R22 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xfj, PDBe:7xfj, PDBj:7xfj
PDBsum7xfj
PubMed37339965
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]