Structure of PDB 7x9e Chain C Binding Site BS01

Receptor Information
>7x9e Chain C (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGGGVVQPGGSLRLSCEASGFSFKDYGMHWIRQTGLEWISRISGD
TRGTSYVDSVKGRFIVSRDNSRNSLFLQMNSLRSEDTALYYCAALVIVAA
GDDFDLWGQGTVVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEP
Ligand information
>7x9e Chain F (length=15) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSKRSFIEDLLFNKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x9e Neutralization mechanism of a human antibody with pan-coronavirus reactivity including SARS-CoV-2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D31 Y32 R50 L99 V100 I101 V102 A106 D108 F110
Binding residue
(residue number reindexed from 1)		D30 Y31 R46 L95 V96 I97 V98 A100 D102 F104
External links