Structure of PDB 7x8b Chain C Binding Site BS01

Receptor Information

>7x8b Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVV
FWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTY
DLFLNLEGNPPVNHLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEG

Ligand information

>7x8b Chain B (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AARK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7x8b Hotspot mutations in the structured ENL YEATS domain link aberrant transcriptional condensates and cancer.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R121 E123
Binding residue (residue number reindexed from 1)	R119 E121

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Biological Process

External links

PDB	RCSB:7x8b, PDBe:7x8b, PDBj:7x8b
PDBsum	7x8b
PubMed	36272410
UniProt	Q03111\|ENL_HUMAN Protein ENL (Gene Name=MLLT1)

[Back to BioLiP]