Structure of PDB 7x7q Chain C Binding Site BS01

Receptor Information
>7x7q Chain C (length=135) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPSVGEPVTLHTH
LVVREDAHLLYGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVR
CVQAQDTSTLVKIPGVGKKTAERLLVELKDRFKAW
Ligand information
>7x7q Chain I (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atattataatatataataataaatatttaatattataata
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x7q Cryo-EM structure of the RuvAB-Holliday junction intermediate complex from Pseudomonas aeruginosa.
Resolution7.02 Å
Binding residue
(original residue number in PDB)		G115 V116 G117 K119 T120
Binding residue
(residue number reindexed from 1)		G115 V116 G117 K119 T120
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
GO:0009378 four-way junction helicase activity
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0032508 DNA duplex unwinding
Cellular Component
GO:0005737 cytoplasm
GO:0009379 Holliday junction helicase complex
GO:0048476 Holliday junction resolvase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x7q, PDBe:7x7q, PDBj:7x7q
PDBsum7x7q
PubMed37025142
UniProtQ51425|RUVA_PSEAE Holliday junction branch migration complex subunit RuvA (Gene Name=ruvA)

[Back to BioLiP]