Structure of PDB 7wnr Chain C Binding Site BS01

Receptor Information

>7wnr Chain C (length=49) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQ

Ligand information

>7wnr Chain A (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggttatactatctgta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7wnr Structural and mutational analysis of MazE6-operator DNA complex provide insights into autoregulation of toxin-antitoxin systems.
Resolution	N/A
Binding residue (original residue number in PDB)	K5 F15 R29 S30
Binding residue (residue number reindexed from 1)	K2 F12 R26 S27

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Biological Process

External links

PDB	RCSB:7wnr, PDBe:7wnr, PDBj:7wnr
PDBsum	7wnr
PubMed	36109664
UniProt	P9WJ87\|MAZE6_MYCTU Antitoxin MazE6 (Gene Name=mazE6)

[Back to BioLiP]