Structure of PDB 7wkv Chain C Binding Site BS01

Receptor Information
>7wkv Chain C (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHT
VDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVI
QKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSD
SALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDI
KERRAVIILRKTRLDAPRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wkv Mechanisms of substrate recognition and N6-methyladenosine demethylation revealed by crystal structures of ALKBH5-RNA complexes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P128 L129 R130 Y139 Y141 G142 R148 I201 V202 S203 H204 V205 F234 P236
Binding residue
(residue number reindexed from 1)		P55 L56 R57 Y66 Y68 G69 R75 I128 V129 S130 H131 V132 F161 P163
Enzymatic activity
Enzyme Commision number 1.14.11.53: mRNA N(6)-methyladenine demethylase.
Gene Ontology
Molecular Function
GO:0035515 oxidative RNA demethylase activity
Biological Process
GO:0006397 mRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7wkv, PDBe:7wkv, PDBj:7wkv
PDBsum7wkv
PubMed35333330
UniProtQ6P6C2|ALKB5_HUMAN RNA demethylase ALKBH5 (Gene Name=ALKBH5)

[Back to BioLiP]