Structure of PDB 7wfy Chain C Binding Site BS01

Receptor Information
>7wfy Chain C (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFN
DEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLK
YPYKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wfy Vav2 is a novel APP-interacting protein that regulates APP protein level.
Resolution2.449 Å
Binding residue
(original residue number in PDB)
R680 R698 R700 K718 H719 K721 T732 S755 F756 Q758
Binding residue
(residue number reindexed from 1)
R16 R34 R36 K54 H55 K57 T68 S91 F92 Q94
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7wfy, PDBe:7wfy, PDBj:7wfy
PDBsum7wfy
PubMed35882892
UniProtP52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 (Gene Name=VAV2)

[Back to BioLiP]