Structure of PDB 7w27 Chain C Binding Site BS01

Receptor Information
>7w27 Chain C (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPSPYLLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTAENLRLQYNHS
GACNKKQLDPTRLRLIRHYVEAVYPVEKMEEVWHYECIPSIDERCRRPNR
KKCDILKKAKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w27 Distinct structural bases for sequence-specific DNA binding by mammalian BEN domain proteins.
Resolution1.49 Å
Binding residue
(original residue number in PDB)
S735 N738 E807 R811 R814 K822
Binding residue
(residue number reindexed from 1)
S21 N24 E93 R97 R100 K108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000183 rDNA heterochromatin formation
Cellular Component
GO:0000792 heterochromatin

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7w27, PDBe:7w27, PDBj:7w27
PDBsum7w27
PubMed35144965
UniProtQ5T5X7|BEND3_HUMAN BEN domain-containing protein 3 (Gene Name=BEND3)

[Back to BioLiP]