Structure of PDB 7vs4 Chain C Binding Site BS01

Receptor Information
>7vs4 Chain C (length=374) Species: 43263 (Pseudomonas alcaligenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WQMVKFGDIAKHISKRVEPSETDLDIYVGLEHLDPDSLKIKRYGVPSDVA
GQKLLVKKGQIIFGKRRAYQRKVAVADWDCICSAHAMVLEPLSDKVIPEF
LPFFMQSDSFMNRAVAISEGSLSPTIKWKTLSSQSFLMPSLTTQATLIKI
LSKISEVESSLESAKLSLQLLSSAFIDELLNHDKNWTIVRAGEACSLITK
GASPRWQGFEYAADGSLFVTSENIQHWAVDISSPKYIPDEFSEKNLRRSQ
LRAGDVLVNIVGASIGRCALWDGSHEKANINQAVALLRPKPELDSRWLLA
QLYSKRGQEYFGLSAVDNARPNLSLKSLSDFEFYLPPIEIQKKTMDIFEL
FSSKVISNKKLTLKAIKSSLVNNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vs4 Molecular insights into DNA recognition and methylation by non-canonical type I restriction-modification systems.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		S23 R25 H94 G129 S130 L131 K136 K138 S212 R214 W215 Y220 T229 S230 E231 V270 G271 A272 S273 R276 N290 Q291 A292 R329
Binding residue
(residue number reindexed from 1)		S14 R16 H85 G120 S121 L122 K127 K129 S203 R205 W206 Y211 T220 S221 E222 V261 G262 A263 S264 R267 N281 Q282 A283 R320
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 22 10:40:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7vs4', asym_id = 'C', bs = 'BS01', title = 'Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7vs4', asym_id='C', bs='BS01', title='Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '7vs4', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='7vs4', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>