Structure of PDB 7vru Chain C Binding Site BS01

Receptor Information

>7vru Chain C (length=369) Species: 43263 (Pseudomonas alcaligenes)

WQMVKFGDIAKHISKRVEPSETDLDIYVGLEHLDPDSLKIKRYGVPSDVA
GQKLLVKKGQIIFGKRRAYQRKVAVADWDCICSAHAMVLEPLSDKVIPEF
LPFFMQSDSFMNRAVAISEGSLSPTIKWKTLSSQSFLMPSLTTQATLIKI
LSKISEVESSLESAKLSLQLLSSAFIDELKNWTIVRAGEACSLITKGASP
RWQGFEYAADGSLFVTSENIQHWAVDISSPKYIPDEFSEKNLRRSQLRAG
DVLVNIVGASIGRCALWDGSHEKANINQAVALLRPKPELDSRWLLAQLYS
KRGQEYFGLSAVDNARPNLSLKSLSDFEFYLPPIEIQKKTMDIFELFSSK
VISNKKLTLKAIKSSLVNN

Ligand information

>7vru Chain H (length=25)

tcgaaaacccgcactattgcaacag

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7vru Molecular insights into DNA recognition and methylation by non-canonical type I restriction-modification systems.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): S23 R25 H94 S130 L131 K136 R214 W215 Y220 T229 S230 E231 V270 G271 A272 S273 R276 N290 Q291 R329
• Binding residue (residue number reindexed from 1): S14 R16 H85 S121 L122 K127 R201 W202 Y207 T216 S217 E218 V257 G258 A259 S260 R263 N277 Q278 R316

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 10:16:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7vru', asym_id = 'C', bs = 'BS01', title = 'Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7vru', asym_id='C', bs='BS01', title='Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '7vru', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='7vru', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>