Structure of PDB 7uzz Chain C Binding Site BS01

Receptor Information
>7uzz Chain C (length=205) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSKIKISGTIEVVTGLHIGGGGDSPVVRDLQTKLPIIPGSSIKGKMRNLL
AKHFGLKMKQESHNQDDERVLRLFGSSEKGNIQRARLQISDAFFSEKTKE
HFAQNDIAYTETKFENTINRLTAVANPRQIERVTRGSEFDFVFIYNVDEE
SQVEDDFENIEKAIHLLENDYLGGGGTRGNGRIQFKDTNIETVVGEYDST
NLKIK
Ligand information
>7uzz Chain G (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacacguaugccgaaguauauaaau
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uzz Structures of an active type III-A CRISPR effector complex.
Resolution4.45 Å
Binding residue
(original residue number in PDB)		I19 G21 S49 S50 G53 K54 N57 G84 S85 S86 R93 F123 E124 N125 T126 I127 G182 G183 G184 R187
Binding residue
(residue number reindexed from 1)		I18 G20 S40 S41 G44 K45 N48 G75 S76 S77 R84 F114 E115 N116 T117 I118 G173 G174 G175 R178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uzz, PDBe:7uzz, PDBj:7uzz
PDBsum7uzz
PubMed35714601
UniProtQ5HK91

[Back to BioLiP]