Structure of PDB 7uxj Chain C Binding Site BS01

Receptor Information

>7uxj Chain C (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYK
GSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILS
MANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN
GKTSKKITIADCGQLE

Ligand information

>7uxj Chain F (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PECHIEAYWCI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uxj De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution	2.07 Å
Binding residue (original residue number in PDB)	R55 R148 N149
Binding residue (residue number reindexed from 1)	R56 R149 N150

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0005178	integrin binding
GO:0005515	protein binding
GO:0016018	cyclosporin A binding
GO:0046790	virion binding
GO:0051082	unfolded protein binding
GO:1904399	heparan sulfate binding

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0001933	negative regulation of protein phosphorylation
GO:0001934	positive regulation of protein phosphorylation
GO:0006457	protein folding
GO:0006469	negative regulation of protein kinase activity
GO:0006915	apoptotic process
GO:0019076	viral release from host cell
GO:0030168	platelet activation
GO:0030182	neuron differentiation
GO:0030593	neutrophil chemotaxis
GO:0030595	leukocyte chemotaxis
GO:0032148	activation of protein kinase B activity
GO:0032873	negative regulation of stress-activated MAPK cascade
GO:0034389	lipid droplet organization
GO:0034599	cellular response to oxidative stress
GO:0042118	endothelial cell activation
GO:0043410	positive regulation of MAPK cascade
GO:0045069	regulation of viral genome replication
GO:0045070	positive regulation of viral genome replication
GO:0050714	positive regulation of protein secretion
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0060352	cell adhesion molecule production
GO:0061944	negative regulation of protein K48-linked ubiquitination
GO:0070527	platelet aggregation
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1903901	negative regulation of viral life cycle
GO:2001233	regulation of apoptotic signaling pathway

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0031982	vesicle
GO:0032991	protein-containing complex
GO:0034774	secretory granule lumen
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uxj, PDBe:7uxj, PDBj:7uxj
PDBsum	7uxj
PubMed	36534810
UniProt	P62937\|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (Gene Name=PPIA)

[Back to BioLiP]