Structure of PDB 7uxa Chain C Binding Site BS01

Receptor Information

>7uxa Chain C (length=200) Species: 9606 (Homo sapiens)

IFRAEMINNNVIVRNAEDIEQLYGKGYFGKGILEYLQLSLEEAFFLVYAL
GCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFRSKGWVPKVGLK
YGTDLLLARKGPPFYAASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVS
VNVSAELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSD

Ligand information

>7uxa Chain E (length=78)

ggcucuguggcgcaauggauagcgcauuggacuucuagagcaauucaaag
guuguggguucgaaucccaccagagucg

<<<<<<<..<<<<........>>>>.<<<<.<<<...>>>....>>>>..
...<<<<<.......>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7uxa Structural basis for pre-tRNA recognition and processing by the human tRNA splicing endonuclease complex.
• Resolution: 3.28 Å
• Binding residue (original residue number in PDB): R409 N413 R452 S456 R459
• Binding residue (residue number reindexed from 1): R148 N152 R191 S195 R198

Enzymatic activity

• Enzyme Commision number: 4.6.1.16: tRNA-intron lyase.

Gene Ontology

Molecular Function

• GO:0000213 tRNA-intron endonuclease activity
• GO:0003676 nucleic acid binding
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0000379 tRNA-type intron splice site recognition and cleavage
• GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing

Cellular Component

• GO:0000214 tRNA-intron endonuclease complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005813 centrosome
• GO:0005829 cytosol

External links

• PDB: RCSB:7uxa, PDBe:7uxa, PDBj:7uxa
• PDBsum: 7uxa
• PubMed: 37231153
• UniProt: Q8NCE0|SEN2_HUMAN tRNA-splicing endonuclease subunit Sen2 (Gene Name=TSEN2)