Structure of PDB 7uwh Chain C Binding Site BS01

Receptor Information
>7uwh Chain C (length=190) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLVAGVDAVGRGPLVGAVVTAAVILDPARPIAGLNDSKKLSEKRRLALY
EEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEYVLID
GNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYG
FAQHKGYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uwh RNA polymerase drives ribonucleotide excision DNA repair in E. coli.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N82 L84 P166 F187 G188 P189
Binding residue
(residue number reindexed from 1)		N74 L76 P158 F179 G180 P181
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006298 mismatch repair
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
GO:1990516 ribonucleotide excision repair
Cellular Component
GO:0005737 cytoplasm
GO:0032299 ribonuclease H2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uwh, PDBe:7uwh, PDBj:7uwh
PDBsum7uwh
PubMed37196657
UniProtP10442|RNH2_ECOLI Ribonuclease HII (Gene Name=rnhB)

[Back to BioLiP]