Structure of PDB 7uv7 Chain C Binding Site BS01

Receptor Information

>7uv7 Chain C (length=212) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVH
INPYLIPFFIGRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSL
KIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGR
QTTHIVFSFRDI

Ligand information

>7uv7 Chain A (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acctgtgacaaattgccctca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uv7 Designed crystalline assemblies of protein and DNA enable site-specific installation of a guest protein, DNA, and small molecule.
Resolution	3.02 Å
Binding residue (original residue number in PDB)	R33 E77 R200 P202 R205 R206 R233 Q234
Binding residue (residue number reindexed from 1)	R20 E58 R167 P169 R172 R173 R200 Q201

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7uv7, PDBe:7uv7, PDBj:7uv7
PDBsum	7uv7
PubMed	37407546
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]