Structure of PDB 7usp Chain C Binding Site BS01

Receptor Information
>7usp Chain C (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYE
VRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPV
DLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7usp Characterization of caspase-2 inhibitors based on specific sites of caspase-2-mediated proteolysis.
Resolution2.85 Å
Binding residue
(original residue number in PDB)
R64 H121 C163
Binding residue
(residue number reindexed from 1)
R30 H87 C129
Enzymatic activity
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7usp, PDBe:7usp, PDBj:7usp
PDBsum7usp
PubMed35642311
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]