Structure of PDB 7uml Chain C Binding Site BS01

Receptor Information
>7uml Chain C (length=172) Species: 11277 (Vesicular stomatitis Indiana virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKI
LAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEH
FRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALM
FGLIVEKKASGAWVLDSISHFK
Ligand information
>7uml Chain F (length=17) Species: 11277 (Vesicular stomatitis Indiana virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSYFGVDEMDTYDPNQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uml Visualizing molecular interactions that determine assembly of a bullet-shaped vesicular stomatitis virus particle.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		N163 G165 K168
Binding residue
(residue number reindexed from 1)		N106 G108 K111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0039660 structural constituent of virion
Biological Process
GO:0006915 apoptotic process
GO:0016310 phosphorylation
GO:0039522 symbiont-mediated suppression of host mRNA export from nucleus
GO:0039602 symbiont-mediated suppression of host transcription initiation from RNA polymerase II promoter
GO:0039702 viral budding via host ESCRT complex
Cellular Component
GO:0016020 membrane
GO:0019031 viral envelope
GO:0030430 host cell cytoplasm
GO:0033644 host cell membrane
GO:0033645 host cell endomembrane system
GO:0042025 host cell nucleus
GO:0044200 host cell nuclear membrane
GO:0044423 virion component
GO:0055036 virion membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uml, PDBe:7uml, PDBj:7uml
PDBsum7uml
PubMed35970826
UniProtP03519|MATRX_VSIVA Matrix protein (Gene Name=M)

[Back to BioLiP]