Structure of PDB 7ud5 Chain C Binding Site BS01

Receptor Information
>7ud5 Chain C (length=106) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSV
LLPKKT
Ligand information
>7ud5 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ud5 Multistate structures of the MLL1-WRAD complex bound to H2B-ubiquitinated nucleosome.
Resolution4.25 Å
Binding residue
(original residue number in PDB)		K15 R17 G28 R32 R42 R77
Binding residue
(residue number reindexed from 1)		K1 R3 G14 R18 R28 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ud5, PDBe:7ud5, PDBj:7ud5
PDBsum7ud5
PubMed36095189
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]