Structure of PDB 7u7o Chain C Binding Site BS01

Receptor Information
>7u7o Chain C (length=216) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYRYESFPWFIKPAHSPSRGLYSV
HINPYLIPFFINRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVS
LKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKG
RQTTHIVFSFRDITSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u7o Towards automated crystallographic structure refinement with phenix.refine.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		R33 E77 R200 M201 P202 R205 R206 R233 Q234
Binding residue
(residue number reindexed from 1)		R20 E58 R168 M169 P170 R173 R174 R201 Q202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7u7o, PDBe:7u7o, PDBj:7u7o
PDBsum7u7o
PubMed37407546
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]